IGF-1 LR3 1mg
Researched Benefits:
- Promotes potent IGF-1R tyrosine kinase phosphorylation to interrogate PI3K/Akt and MAPK/ERK intracellular signaling pathway cross-talk.
- Stimulates mitogenic responses in vitro to delineate specific mechanisms governing cellular proliferation and survival under experimental conditions.
- Facilitates the analysis of protein translation efficiency and metabolic flux within primary myogenic or osteogenic cell cultures.
- Utilized as a high-affinity ligand for competitive binding assays and characterizing endocrine-mediated signal transduction kinetics in vitro.
- Delivered today (order Mon-Fri before 12:00, delivery between 17:00 and 22:00)
- Including shipping costs, sent by blonwe.com
- Pick up at a blonwe.com collection point is possible
- 30 days to change your mind and free returns
- Day and night customer service
Description
Description
IGF-1 LR3 1mg is an engineered variant of the insulin-like growth factor 1 (IGF-1) designed to increase potency and stability, making it ideal for research into growth factor-related processes. Produced using state-of-the-art synthesis methods, our IGF-1 LR3 offers exceptional purity and biological activity for demanding research needs.
Key Features:
- Engineered for enhanced biological activity and prolonged half-life compared to native IGF-1.
- Subject to strict quality control protocols to ensure product reliability and consistency.
- Offered in lyophilized form to ensure stability during storage and handling.
Applications:
- Exploring effects on cell growth, differentiation, and survival.
- Studying metabolic effects related to muscle development and aging.
- Researching potential therapeutic applications in muscle wasting diseases and metabolic disorders.
Specifications and Documentation
Â
- Material Safety Data Sheet (MSDS):Â Coming Soon.
- Handling and Storage Instructions:Â Coming Soon.
Â
IGF-1 LR3 1mg is widely appreciated in the research community for its role in advanced studies of growth factors, offering insights into cellular mechanisms and potential therapeutic targets.
Additional information
| CAS No. | 946870-92-4 |
|---|---|
| Purity | ≥99% |
| Sequence | MFPAMPLSSLFVNAGPVCGLRIFYNNKQYWNKPTGYGSSIRRAPQTGIVDCCFRSCDLRRLEMYCAPLKPAKSA |
| Molecular Formula | C331H519N109O101 |
| Molecular Weight | 9117.60 g/mol |
| Synthesis | Solid-phase synthesis |
| Format | Lyophilized powder |
| Solubility | Soluble in water or 1% acetic acid |
| Stability & Storage | Stable for up to 24 months at -20°C. After reconstitution, may be stored at 4°C for up to 4 weeks or at -20°C for up to 6 months. |
| Applications | Cell growth and differentiation studies, muscle development and aging research, therapeutic research in muscle wasting and metabolic disorders |
| Appearance | White lyophilized powder |
| Shipping Conditions | Shipped at ambient temperature; once received, store at -20°C |
| Regulatory/Compliance | Manufactured in a facility that adheres to cGMP guidelines |
| Safety Information | Refer to provided MSDS |
















sinan –
Sed perspiciatis unde omnis iste natus aliquam sit voluptatem exercitationem doloremque laudantium.
sinan –
Commodi perspiciatis unde omnis iste natus aliquam sit voluptatem exercitationem doloremque laudantium.
sinan –
Sed perspiciatis unde omnis iste natus error sit voluptatem accusantium doloremque laudantium.