IGF-1 LR3 1mg

$89.99
In Stock

Researched Benefits:

  • Promotes potent IGF-1R tyrosine kinase phosphorylation to interrogate PI3K/Akt and MAPK/ERK intracellular signaling pathway cross-talk.
  • Stimulates mitogenic responses in vitro to delineate specific mechanisms governing cellular proliferation and survival under experimental conditions.
  • Facilitates the analysis of protein translation efficiency and metabolic flux within primary myogenic or osteogenic cell cultures.
  • Utilized as a high-affinity ligand for competitive binding assays and characterizing endocrine-mediated signal transduction kinetics in vitro.

This product has been added to 45 people'scarts.

In Stock
  • Delivered today (order Mon-Fri before 12:00, delivery between 17:00 and 22:00)
  • Including shipping costs, sent by blonwe.com
  • Pick up at a blonwe.com collection point is possible
  • 30 days to change your mind and free returns
  • Day and night customer service

Description

Description

IGF-1 LR3 1mg is an engineered variant of the insulin-like growth factor 1 (IGF-1) designed to increase potency and stability, making it ideal for research into growth factor-related processes. Produced using state-of-the-art synthesis methods, our IGF-1 LR3 offers exceptional purity and biological activity for demanding research needs.

Key Features:

  • Engineered for enhanced biological activity and prolonged half-life compared to native IGF-1.
  • Subject to strict quality control protocols to ensure product reliability and consistency.
  • Offered in lyophilized form to ensure stability during storage and handling.

Applications:

  • Exploring effects on cell growth, differentiation, and survival.
  • Studying metabolic effects related to muscle development and aging.
  • Researching potential therapeutic applications in muscle wasting diseases and metabolic disorders.

Specifications and Documentation

 

  • Material Safety Data Sheet (MSDS): Coming Soon.
  • Handling and Storage Instructions: Coming Soon.

 

IGF-1 LR3 1mg is widely appreciated in the research community for its role in advanced studies of growth factors, offering insights into cellular mechanisms and potential therapeutic targets.

Additional information

CAS No. 946870-92-4
Purity ≥99%
Sequence MFPAMPLSSLFVNAGPVCGLRIFYNNKQYWNKPTGYGSSIRRAPQTGIVDCCFRSCDLRRLEMYCAPLKPAKSA
Molecular Formula C331H519N109O101
Molecular Weight 9117.60 g/mol
Synthesis Solid-phase synthesis
Format Lyophilized powder
Solubility Soluble in water or 1% acetic acid
Stability & Storage Stable for up to 24 months at -20°C. After reconstitution, may be stored at 4°C for up to 4 weeks or at -20°C for up to 6 months.
Applications Cell growth and differentiation studies, muscle development and aging research, therapeutic research in muscle wasting and metabolic disorders
Appearance White lyophilized powder
Shipping Conditions Shipped at ambient temperature; once received, store at -20°C
Regulatory/Compliance Manufactured in a facility that adheres to cGMP guidelines
Safety Information Refer to provided MSDS

3 reviews for IGF-1 LR3 1mg

4.67

Average of 3 reviews

  1. sinan

    Sed perspiciatis unde omnis iste natus aliquam sit voluptatem exercitationem doloremque laudantium.

  2. sinan

    Commodi perspiciatis unde omnis iste natus aliquam sit voluptatem exercitationem doloremque laudantium.

  3. sinan

    Sed perspiciatis unde omnis iste natus error sit voluptatem accusantium doloremque laudantium.

Add a review